Download Molekularbiologische Grundlagen der Gastroenterologie by J. Schmielau, H. Kalthoff, C. Roeder, W. Schmiegel (auth.), PDF

Download Molekularbiologische Grundlagen der Gastroenterologie by J. Schmielau, H. Kalthoff, C. Roeder, W. Schmiegel (auth.), PDF

By J. Schmielau, H. Kalthoff, C. Roeder, W. Schmiegel (auth.), Prof. Dr. med. Hans G. Beger, Prof. Dr. med. Michael P. Manns, Prof. Dr. med. Heiner Greten (eds.)

Ausgehend von aktuellsten Daten werden die molekularbiologischen Grundlagen von gastrointestinalen Malignomen, des Leberzellkarzinoms, molekulare Mechanismen von Stoffwechseldefekten, die Interaktion von Hormonen und Zytokinen in der law von gastrointestinalen Funktionen, die Bedeutung von Sauerstoffradikalen und Stickstoffmonoxyd in der Gastroenterologie sowie der Darm als Immunorgan und erste Ansätze zur Gentherapie in der Gastroenterologie dargestellt. Das Buch erröffnet einen kausalen Zugang zur Gastroenterologie, neue - molekularbiologische - diagnostische Ansätze werden ebenso dargestellt wie erste gentherapeutische Möglichkeiten.

Show description

Read Online or Download Molekularbiologische Grundlagen der Gastroenterologie PDF

Best german_12 books

Bildtafeln für die genetische Beratung

Das Anschauungsmaterial "Bildtafeln f}r die genetische Beratung" entstand aus den reichhaltigen und langj{hrigen Erfahrungen des Autors auf diesem Gebiet. Es besteht aus Bildern und Zeichnungen }ber medizinisch-genetische Befund , biologische Vorg{nge sowie Informationen }ber die verschiedenen Untersuchungsm|glichkeiten.

Fibel der gastrointestinalen Leitsymptome

Die Fibel erklärt in schematischen Übersichten mit kurzen Erläuterungen knapp und verständlich die wichtigsten gastrointestinalen Leitsymptome. Der vielbeschäftigte Arzt erhält damit eine praxisbezogene, übersichtliche info über die notwendigen ersten diagnostischen und therapeutischen Maßnahmen.

Beurteilung von Analysenverfahren und -Ergebnissen

Einleitung Die analytische Chemie ist eine Kunst, sie zu beherrschen erfordert theoretische Kenntnisse, handwerkliches Können und persönliche Er­ fahrung. Ohne umfassende theoretische Kenntnisse geht der Überblick über die mannigfachen Möglichkeiten und über die Grenzen dieses Ge­ bietes verloren, ohne sauberes handwerkliches Können läßt sich keine noch so einfache examine einwandfrei durchführen, ohne langjährige persönliche Erfahrung ist keine Beurteilung eines analytischen difficulties und keine Bewertung von Analysenergebnissen möglich.

Additional resources for Molekularbiologische Grundlagen der Gastroenterologie

Example text

I . I I I· I I I I: I . MCK-I0 RLPGGVEC~GPAMAWEGEPMRHNLGGNLGDPRARA VSVPLGGRVARP T CCK-2 47 4B 97 97 147 147 197 197 246 245 296 295 345 345 IKCQYMFADTWMHFSEITPQSDAAMYNNSEALPTS............... : . : I I: . I " II I I . : I. I . I I ... VVNNSSPALGGTFPPAPWWPPGPPPTN 3BO 394 CCK-2 .... ::111 I. MCK-IO FSSLELEPRGQQPVAKAEGSPTAILIGCLVAIILLLLLIIALMLWRLHWR 444 CCK-2 476 426 KMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFP : : I . I I. II : I " I : I I I I: I : I· " I I .. : .... MCK-IO RLLSKAERRVLEEELTVHLSVFGDTILINNRPGPREP ............

1991) Proc Nat! Acad Sci USA 88:8691-8695 Ullrich A, Coussens L, Hayflick JS et al. (1984) Nature 309:418-425 Ullrich A, Schlessinger J (1990) Cell 61:203-212 Willks AF (1989) Proc Nat! Acad Sci USA 86:1603-1607 Yamamoto T, Kamata N, Kawano H et al. (1986) Cancer Res 46:414-416 Yarden Y, Kuang W-J, Yang-Feng T et al. (1987) EMBO J 6:3341-3351 Yu H, Chen JK, Feng S et al. (1994) Cell 76:933-945 Yoneda T, Lyall R, Alsine MM et al. (1991) Cancer Res 51:4430-4435 Zerlin M, Julius MA, Goldfarb M (1993) Oncogene 8:2731-2739 27 Hyperexpression von Wachstumsfaktoren* H.

Additionally, it will be demonstrated that expression of the p 16 gene (multiple tumor suppressor (MTS)-l) is a rare event in pancreatic tumor cells. The p 16 gene product was characterized as inhibitor of the cdk-4 cyclin-dependent kinase. Einleitung Mutationen, Mikrodeletionen und Allelverluste im p 53-Tumorsuppressorgen stellen unverandert die haufigste genetische Veranderung in einer Vielzahl von Tumoren dar CObersicht [7, 17]). Die Einsicht in die Mechanismen, durch die p 53 zur malignen Transformation beitragt, ist in den letzten beiden Jahren erheblich vertieft worden: durch die Kokristallisation eines p 53-Fragments mit einer DNABindungssequenz [6] gelang der Nachweis, daB die Mehrzahl der p53 Mutationen ("hot spot regions") genau die Aminosauren betreffen, die unmittelbar oder mittelbar die DNA-Interaktion bewerkstelligen [26].

Download PDF sample

Rated 4.05 of 5 – based on 36 votes
Comments are closed.